PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G40650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 789aa    MW: 84776.7 Da    PI: 6.9121
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G40650.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.82.5e-2097152156
                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   r++ +++t+eq++++e+lF+++++p++++r+ L+k+lgL+ rqVk+WFqNrR++ k
  OB01G40650.1  97 RKTYHRHTAEQIRVMEALFKESPHPDERQRQLLSKQLGLSARQVKFWFQNRRTQIK 152
                   78999***********************************************9877 PP

2START177.86.3e-562925201206
                   HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
         START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv........dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                   ela +a++elv++ +++ep+Wv+ +    +++n+de+++ f +++          s+e++r++g+   ++++ v  ++d+  +W+e ++     a++
  OB01G40650.1 292 ELAGRALDELVAMCSSGEPLWVRAVetgrDILNYDEYVRLFRRDHDgsgdqlpgWSVEVSRECGLAYLDTMQFVHAFMDVE-RWKELFPsmisNAAV 387
                   57899************************************9998899***********************9999999999.****9999999**** PP

                   EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
         START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwvehv 170
                   l+vis+g      g++qlm+aelq+l+p+vp R+f+f+R++++l a++w+ivdvS+  e +     ss vR+ + pSg++ie+  ng +kvtwveh+
  OB01G40650.1 388 LDVISTGeddgrdGVVQLMYAELQMLTPMVPtREFYFARHCKKLAAERWAIVDVSTFDEFEAGVhASSPVRCFKKPSGCVIEEQTNGQCKVTWVEHT 484
                   *******************************************************96555544459******************************* PP

                   E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
         START 171 dlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                    ++ r+++ ++r +  sg+a+ga++wva+lq qce+
  OB01G40650.1 485 RCRRRTVPPVYRAVTASGVAFGARRWVAALQLQCER 520
                   **********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.12E-2081155IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.9E-2284148IPR009057Homeodomain-like
PROSITE profilePS5007117.47594154IPR001356Homeobox domain
SMARTSM003891.5E-1796158IPR001356Homeobox domain
CDDcd000869.65E-1897152No hitNo description
PfamPF000461.0E-1797152IPR001356Homeobox domain
PROSITE patternPS000270129152IPR017970Homeobox, conserved site
PROSITE profilePS5084840.482283523IPR002913START domain
SuperFamilySSF559611.21E-31286520No hitNo description
CDDcd088758.57E-102287519No hitNo description
PfamPF018521.9E-46292520IPR002913START domain
SMARTSM002343.4E-49292520IPR002913START domain
Gene3DG3DSA:3.30.530.202.3E-6329484IPR023393START-like domain
SuperFamilySSF559611.37E-5542633No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 789 aa     Download sequence    Send to blast
MGTNRPPPRT KDFFAAPVLS LSLAGVFGRD NGPPAAAAAG GDELEEGDEV QAAAGEAVEI  60
SSSGNTGPGG SRSQSGGGSG EDGGHDAADG GGDRKRRKTY HRHTAEQIRV MEALFKESPH  120
PDERQRQLLS KQLGLSARQV KFWFQNRRTQ IKAIQERHEN SLLKSVLDKL QQEHRAMREL  180
ARKPSRCPNC GAAAASGDAA VAAATREQRL RLENAKLKAE VLHAPFPACC MACMALTDTD  240
LNSFQIEKLR GTPGKATAAD GAASPPRSAT AARTNCKSPP LHGHDDRPRI LELAGRALDE  300
LVAMCSSGEP LWVRAVETGR DILNYDEYVR LFRRDHDGSG DQLPGWSVEV SRECGLAYLD  360
TMQFVHAFMD VERWKELFPS MISNAAVLDV ISTGEDDGRD GVVQLMYAEL QMLTPMVPTR  420
EFYFARHCKK LAAERWAIVD VSTFDEFEAG VHASSPVRCF KKPSGCVIEE QTNGQCKVTW  480
VEHTRCRRRT VPPVYRAVTA SGVAFGARRW VAALQLQCER MVFAVATNVP TRDSNGVSTL  540
AGRRSVLKLA HRMTSSLCRT IGGSRDMMWS RAPKGGGGDD IWWSSRTNSG DDPGEPQGLV  600
TCAALSTWLP VNPTAILDLL RDESRRPEWD VMLPGNSLQI CVNLAKGKDR TNCVTVYAVR  660
PEDGGGSGGG KWVLQDICTN PCESTTAYAA IDAAALQPVT AGHDSSGVAF LPCGFISVMP  720
DGLESRPAVI TASGNVAAGA GSLVTVAFQV LASSSPAATL ATDSLEAATG LVSSTLDKVR  780
KALGCEDDF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126095e-90CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015689947.10.0PREDICTED: homeobox-leucine zipper protein ROC9
SwissprotQ5JMF30.0ROC9_ORYSJ; Homeobox-leucine zipper protein ROC9
TrEMBLJ3L4A90.0J3L4A9_ORYBR; Uncharacterized protein
STRINGOB01G40650.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein